PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 978aa    MW: 111459 Da    PI: 7.6157
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572837.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.52.2e-102002651581
        trihelix  15 remeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                     +++e  ++rgk ++ + +ev++++r++g++r +k+   kw+n+ ++++k+ e+e++++ e++   +y
  XP_012572837.1 200 NQTEFGMSRGKTRADKDKEVAEFLRRHGVNRDAKTAGTKWDNMLGEFRKVYEWERGGEREQV-GKSY 265
                     45666778999********************************************9965555.3445 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561121.71E-17797956IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.102.3E-8817919No hitNo description
CDDcd001807.65E-16817952No hitNo description
Gene3DG3DSA:1.10.510.106.8E-4924955No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MVIDKGDTSK KQHQQTQSSP KATLIESTRP QIVNVVSGST RFISSPLYVS TSATTSSPFE  60
QQQQFETTLN TTKRPRYSGQ WKLLPSPTQQ QQKSSQINIL PTESTTPSPS NPQHHQQQQQ  120
QIHTTASSSD TTSSPSHSPI PILSEGNKLL QESEQVHQQL RKGKYVSPVW KPNEMLWLAR  180
AWKEQYQTGS DSSSKTEQKN QTEFGMSRGK TRADKDKEVA EFLRRHGVNR DAKTAGTKWD  240
NMLGEFRKVY EWERGGEREQ VGKSYFRLSP YERKLHRLPA SFDEEVFEEL SMFMGSRMRS  300
SHGRTSSNFV FGDENRTRSL PPPRPFKDDD LPLSARAKQL TMTSGGEAFF HGHRGNLLGL  360
DSLLEISTPC SSSKELRRIG KIRMTWEESL SLWGEEGEVY RGRVKVQSSS FLHADEISFF  420
DDAMVPCPLE CFEDGSLKGF SVDRFVSGQQ VNVIGRRKSS SASSSGFAER VQPLTKPIPL  480
RSIVSLDFRD PTEYYMDCLL RVSSQQSLPP LFELKNHIQE PPHENFRFPL RKEVFEDLPQ  540
GKEFFFTTTS EPLDCRSIIY DIVGPIIRTN NNNNNNPSLL PFSSRDSFIG LWDDCINRVV  600
SRFCPDDFVI TRKPFSSISQ DTLLLQDEWP NVTGFVNNFC LWRGEECEEL KDNNIIQQNP  660
SSTIIQKLLW TYQDLPYILG YYAISNTVTF CALSKSQEGT IIRTDLHQVN LTTPYERFKV  720
LVPCFRIGVL LSMLSKHCCS NTKGNFVYSD FDRYSFGEGV IIEMTPNTSK RVFLEKRKWC  780
SVKEVYEILD HRIPHSEFLF KCNENDMSLV FKPRGIRMKP LNCEELVEAL KFVTKALVAL  840
HDLSFMHRDI RWENVMKRND REREWFVCGF DEAAGAPELN RKEEGGEKVE RGRHAPEMER  900
GLHGVKVDVW GVGYLIMTCG VVGVPKMMRE LMNCCMEQNP EQRPTAADCY HHLLQLQTSL  960
LSGGGGCGGS GGGGRGLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572837.10.0PREDICTED: uncharacterized protein LOC101511257
TrEMBLA0A072TK710.0A0A072TK71_MEDTR; Kinase superfamily protein
STRINGGLYMA09G27590.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.15e-09Trihelix family protein